Structure of PDB 8fl3 Chain NP Binding Site BS02

Receptor Information

>8fl3 Chain NP (length=104) Species: 9606 (Homo sapiens)

RSRRTGAHRAHSLARQMKAKRRRPDLDEIHRELRFDPDLPGGGLHRCLAC
ARYFIDSTNLKTHFRSKDHKKRLKQLSVEPYSQEEAERAAGMGSYVPPRR
LAVP

Ligand information

• Ligand ID: ZN
• InChI: InChI=1S/Zn/q+2
• InChIKey: PTFCDOFLOPIGGS-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Zn++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Zn+2]
• Formula: Zn
• Name: ZINC ION
• ChEMBL: CHEMBL1236970
• DrugBank: DB14532
• PDB chain: 8fl3 Chain NP Residue 500

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8fl3 Principles of human pre-60 S biogenesis.
• Resolution: 2.53 Å
• Binding residue (original residue number in PDB): C63 C66 H79 H85
• Binding residue (residue number reindexed from 1): C47 C50 H63 H69
• Annotation score: 4

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003677 DNA binding
• GO:0005515 protein binding
• GO:0008270 zinc ion binding
• GO:0046872 metal ion binding
• GO:1990275 preribosome binding

Biological Process

• GO:0042254 ribosome biogenesis
• GO:0045944 positive regulation of transcription by RNA polymerase II
• GO:1903026 negative regulation of RNA polymerase II regulatory region sequence-specific DNA binding

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005730 nucleolus
• GO:0005737 cytoplasm

External links

• PDB: RCSB:8fl3, PDBe:8fl3, PDBj:8fl3
• PDBsum: 8fl3
• PubMed: 37410842
• UniProt: O00488|ZN593_HUMAN Zinc finger protein 593 (Gene Name=ZNF593)