Structure of PDB 8fl2 Chain NB Binding Site BS02

Receptor Information

>8fl2 Chain NB (length=81) Species: 9606 (Homo sapiens)

MKRPKLKKASKRMTCHKRYKIQKKVREHHRKLRKEAKKRGHKKPRKDPGV
PNSAPFKEALLREAELRKQRLEELKQQQKLD

Ligand information

>8fl2 Chain L4 (length=117)

gucuacggccauaccacccugaacgcgcccgaucucgucugaucucggaa
gcuaagcagggucgggccugguuaguacuuggaugggccgccugggaaua
ccgggugcuguaggcuu

<<<<<<<<<....<<<<<<<<.....<<<<<..............>>>..
>>....>>>>>>.>><<<<<<<.....<<.<<.<<<.>>>>>.>>....>
>>>>>>>>>>>>>>>..

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8fl2 Principles of human pre-60 S biogenesis.
• Resolution: 2.67 Å
• Binding residue (original residue number in PDB): H29 K42
• Binding residue (residue number reindexed from 1): H29 K42

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0005515 protein binding
• GO:0005525 GTP binding
• GO:0048027 mRNA 5'-UTR binding

Biological Process

• GO:0017145 stem cell division
• GO:0019827 stem cell population maintenance
• GO:0032206 positive regulation of telomere maintenance
• GO:0033235 positive regulation of protein sumoylation
• GO:0042127 regulation of cell population proliferation
• GO:1902895 positive regulation of miRNA transcription
• GO:1904816 positive regulation of protein localization to chromosome, telomeric region

Cellular Component

• GO:0005615 extracellular space
• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005694 chromosome
• GO:0005730 nucleolus
• GO:0016020 membrane
• GO:0016604 nuclear body
• GO:0030496 midbody

External links

• PDB: RCSB:8fl2, PDBe:8fl2, PDBj:8fl2
• PDBsum: 8fl2
• PubMed: 37410842
• UniProt: Q9BVP2|GNL3_HUMAN Guanine nucleotide-binding protein-like 3 (Gene Name=GNL3)