Structure of PDB 5tga Chain N5 Binding Site BS02

Receptor Information
>5tga Chain N5 (length=121) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KALKVRTSATFRLPKTLKLARAPKYASKAVPHYNRLDSYKVIEQPITSET
AMKKVEDGNILVFQVSMKANKYQIKKAVKELYEVDVLKVNTLVRPNGTKK
AYVRLTADYDALDIANRIGYI
Ligand information
>5tga Chain 4 (length=158) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aaacuuucaacaacggaucucuugguucucgcaucgaugaagaacgcagc
gaaaugcgauacguaaugugaauugcagaauuccgugaaucaucgaaucu
uugaacgcacauugcgccccuugguauuccagggggcaugccuguuugag
cgucauuu
.........................................<<<<<<.<<
.....>>>.....(.<<<......>>..............>>>..)...>
>>....<<.....>><<<<<<<<<....>>>>>>>>>.............
........
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5tga Molecular insights into protein synthesis with proline residues.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		L24 R27 P35 T37 L38 R42 S48 K49 P52 H53 Y54 N55 R56 K61 K89 Y93 Q94
Binding residue
(residue number reindexed from 1)		L3 R6 P14 T16 L17 R21 S27 K28 P31 H32 Y33 N34 R35 K40 K68 Y72 Q73
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5tga, PDBe:5tga, PDBj:5tga
PDBsum5tga
PubMed27827794
UniProtP04456|RL25_YEAST Large ribosomal subunit protein uL23 (Gene Name=RPL25)

[Back to BioLiP]