Structure of PDB 7a5i Chain N3 Binding Site BS02

Receptor Information
>7a5i Chain N3 (length=205) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KPKLRFIERAPLVPKVRREPKNLSDIRGPSTEATEFTEGNFAILALGGGY
LHWGHFEMMRLTINRSMDPKNMFAIWRVPAPFKPITRKSVGHRMGGGKGA
IDHYVTPVKAGRLVVEMGGRCEFEEVQGFLDQVAHKLPFAAKAVSRGTLE
KMRKDQEERERNNQNPWTFERIATANMLGIRKVLSPYDLTHKGKYWGKFY
MPKRV
Ligand information
>7a5i Chain l3 (length=23) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SREYWRRLRKQNIWRHNRLSKNK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7a5i Elongational stalling activates mitoribosome-associated quality control.
Resolution3.7 Å
Binding residue
(original residue number in PDB)
E168 E171
Binding residue
(residue number reindexed from 1)
E122 E125
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7a5i, PDBe:7a5i, PDBj:7a5i
PDBsum7a5i
PubMed33243891
UniProtQ9NX20|RM16_HUMAN Large ribosomal subunit protein uL16m (Gene Name=MRPL16)

[Back to BioLiP]