Structure of PDB 6gzx Chain N1 Binding Site BS02

Receptor Information

>6gzx Chain N1 (length=111) Species: 300852 (Thermus thermophilus HB8)

ARLTAYERRKFRVRNRIKRTGRLRLSVFRSLKHIYAQIIDDEKGVTLVSA
SSLALKLKGNKTEVARQVGRALAEKALALGIKQVAFDRGPYKYHGRVKAL
AEGAREGGLEF

Ligand information

>6gzx Chain B1 (length=122)

aaucccccgugcccauagcggcguggaaccacccguucccauuccgaaca
cggaagugaaacgcgccagcgccgaugguacugggcgggcgaccgccugg
gagaguaggucggugcggggga

...<<<<<<<.<..................<<<<<...............
>>>..>>.............<<<...........<<<<....>>>>....
.......>>>..>.>>>>>>>.

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6gzx Cryo-EM structure of the hibernating Thermus thermophilus 100S ribosome reveals a protein-mediated dimerization mechanism.
• Resolution: 4.57 Å
• Binding residue (original residue number in PDB): R25 F29 R30 S31 Q38 I40 V46 T47 V49 S50 L54 K62 T63 P91 Y92 H95 G96 R97 K99
• Binding residue (residue number reindexed from 1): R24 F28 R29 S30 Q37 I39 V45 T46 V48 S49 L53 K61 T62 P90 Y91 H94 G95 R96 K98

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008097 5S rRNA binding
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6gzx, PDBe:6gzx, PDBj:6gzx
• PDBsum: 6gzx
• PubMed: 30301898
• UniProt: Q5SHQ4|RL18_THET8 Large ribosomal subunit protein uL18 (Gene Name=rplR)