Structure of PDB 8wk4 Chain N Binding Site BS02

Receptor Information
>8wk4 Chain N (length=164) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DLNDAQLKFANDVESRIQRRIEAILSPIVGNGNVHAQVTAQLDFANKEQT
EEHYSPNGDASKATLRSRQLNISEQVGAGPRSTQRNETSNYEVDRTIRHT
KMNVGDIERLSVAVVVNYKTLADGKPLPLTADQMKQIEDLTREAMGFSDK
RGDTLNVVNSPFSA
Ligand information
>8wk4 Chain r (length=17) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GVALTLTSSHHIPAQAV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8wk4 Cryo-EM structure of the MS ring with FlgB and FliE within the flagellar motor-hook complex in the CW state.
Resolution3.7 Å
Binding residue
(original residue number in PDB)
R294 S295 Q297 N299 N365 Y366 E367
Binding residue
(residue number reindexed from 1)
R66 S67 Q69 N71 N90 Y91 E92
External links
PDB RCSB:8wk4, PDBe:8wk4, PDBj:8wk4
PDBsum8wk4
PubMed
UniProtP15928|FLIF_SALTY Flagellar M-ring protein (Gene Name=fliF)

[Back to BioLiP]