Structure of PDB 8i0t Chain N Binding Site BS02

Receptor Information

>8i0t Chain N (length=143) Species: 9606 (Homo sapiens)

MPKVKRSRKAPPDGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIF
RIHHQKTRYIFDLFYKRKAISRELYEYCIKEGYADKNLIAKWKKQGYENL
CCLRCIQTRDTNFGTNCICRVPKSKLEVGRIIECTHCGCRGCS

Ligand information

• Ligand ID: ZN
• InChI: InChI=1S/Zn/q+2
• InChIKey: PTFCDOFLOPIGGS-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Zn++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Zn+2]
• Formula: Zn
• Name: ZINC ION
• ChEMBL: CHEMBL1236970
• DrugBank: DB14532
• PDB chain: 8i0t Chain N Residue 201

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8i0t Molecular basis for the activation of human spliceosome
• Resolution: 3.0 Å
• Binding residue (original residue number in PDB): C117 C134 H136
• Binding residue (residue number reindexed from 1): C117 C134 H136
• Annotation score: 4

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0016922 nuclear receptor binding
• GO:0030374 nuclear receptor coactivator activity

Biological Process

• GO:0000398 mRNA splicing, via spliceosome
• GO:0006397 mRNA processing
• GO:0008380 RNA splicing
• GO:0045893 positive regulation of DNA-templated transcription
• GO:2000825 positive regulation of androgen receptor activity

Cellular Component

• GO:0000785 chromatin
• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005681 spliceosomal complex
• GO:0071007 U2-type catalytic step 2 spliceosome

External links

• PDB: RCSB:8i0t, PDBe:8i0t, PDBj:8i0t
• PDBsum: 8i0t
• PubMed: 39068178
• UniProt: P41223|BUD31_HUMAN Protein BUD31 homolog (Gene Name=BUD31)