Structure of PDB 8eu2 Chain N Binding Site BS02

Receptor Information
>8eu2 Chain N (length=95) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Ligand information
>8eu2 Chain J (length=110) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gggagtaatccccttggcggttaaaacgcgggggacagcgcgtacgtgcg
tttaagcggtgctagagctgtctacgaccaattgagcggcctcggcaccg
ggattctcca
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8eu2 Reorientation of INO80 on hexasomes reveals basis for mechanistic versatility.
Resolution2.93 Å
Binding residue
(original residue number in PDB)		R30 K31 Y37
Binding residue
(residue number reindexed from 1)		R3 K4 Y10
External links