Structure of PDB 7uvw Chain N Binding Site BS02

Receptor Information

>7uvw Chain N (length=116) Species: 480119 (Acinetobacter baumannii AB0057)

MNEKKQSRLRRAKSTRLHIRALGATRLCVNRTPRHIYAQVISADGGKVLA
QASTLDASLRSGTTGNIEAATKVGALIAERAKAAGVTKVAFDRSGFKYHG
RIKALADAAREGGLEF

Ligand information

>7uvw Chain B (length=115)

gcuggcgaccauagcaagagugaaccaccugaucccuucccgaacucaga
agugaaaccucuuagcgcugaugguagugugggauuacccaugugagagu
aagucaucgccagcu

<<<<<<<<.....<<<<<<<.....<<<<<<...............>>>.
.>>>....>>>>>.>><<<.......<<<<<<<....>>>>>>>......
.>>>..>>>>>>>>.

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7uvw Streptothricin F is a bactericidal antibiotic effective against highly drug-resistant gram-negative bacteria that interacts with the 30S subunit of the 70S ribosome.
• Resolution: 2.37 Å
• Binding residue (original residue number in PDB): M1 N2 K5 R16 R20 R26 R31 T32 R34 H35 Y37 G45 Q51 R60 N66 I67 H99 G100 R101
• Binding residue (residue number reindexed from 1): M1 N2 K5 R16 R20 R26 R31 T32 R34 H35 Y37 G45 Q51 R60 N66 I67 H99 G100 R101

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008097 5S rRNA binding
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7uvw, PDBe:7uvw, PDBj:7uvw
• PDBsum: 7uvw
• PubMed: 37192172
• UniProt: B7IA23|RL18_ACIB5 Large ribosomal subunit protein uL18 (Gene Name=rplR)