Structure of PDB 7onb Chain N Binding Site BS02

Receptor Information

>7onb Chain N (length=97) Species: 9606 (Homo sapiens)

WDGKPIPYWLYKLHGLNINYNCEICGNYTYRGPKAFQRHFAEWRHAHGMR
CLGIPNTAHFANVTQIEDAVSLWAKLKLQKASERWQPDTEEEYEDSS

Ligand information

>7onb Chain H (length=32)

uaguaucuguucuuaucaguuuaauaucugau

..............<<<<<.<....>.>>>>>

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7onb Structural basis of intron selection by U2 snRNP in the presence of covalent inhibitors.
• Resolution: 3.1 Å
• Binding residue (original residue number in PDB): W387 Y394 W395 K398 N403 R417
• Binding residue (residue number reindexed from 1): W1 Y8 W9 K12 N17 R31

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0005515 protein binding
• GO:0008270 zinc ion binding
• GO:0046872 metal ion binding

Biological Process

• GO:0000375 RNA splicing, via transesterification reactions
• GO:0000389 mRNA 3'-splice site recognition
• GO:0000398 mRNA splicing, via spliceosome
• GO:0006397 mRNA processing
• GO:0008380 RNA splicing
• GO:1903241 U2-type prespliceosome assembly

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005681 spliceosomal complex
• GO:0005684 U2-type spliceosomal complex
• GO:0005686 U2 snRNP
• GO:0016607 nuclear speck
• GO:0071005 U2-type precatalytic spliceosome
• GO:0071013 catalytic step 2 spliceosome

External links

• PDB: RCSB:7onb, PDBe:7onb, PDBj:7onb
• PDBsum: 7onb
• PubMed: 34301950
• UniProt: Q12874|SF3A3_HUMAN Splicing factor 3A subunit 3 (Gene Name=SF3A3)