Structure of PDB 7m4z Chain N Binding Site BS02

Receptor Information
>7m4z Chain N (length=114) Species: 480119 (Acinetobacter baumannii AB0057) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EKKQSRLRRAKSTRLHIRALGATRLCVNRTPRHIYAQVISADGGKVLAQA
STLDASLRSGTTGNIEAATKVGALIAERAKAAGVTKVAFDRSGFKYHGRI
KALADAAREGGLEF
Ligand information
>7m4z Chain B (length=115) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcuggcgaccauagcaagagugaaccaccugaucccuucccgaacucaga
agugaaaccucuuagcgcugaugguagugugggauuacccaugugagagu
aagucaucgccagcu
<<<<<<<<.....<<<<<<<.....<<<<<<...............>>>.
.>>>....>>>>>.>><<<.......<<<<<<<....>>>>>>>......
.>>>..>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7m4z Cryo-EM Determination of Eravacycline-Bound Structures of the Ribosome and the Multidrug Efflux Pump AdeJ of Acinetobacter baumannii.
Resolution2.92 Å
Binding residue
(original residue number in PDB)		K4 R16 R26 R31 T32 R34 H35 Q39 I41 G46 V48 Q51 I67 K97 H99 G100 R101
Binding residue
(residue number reindexed from 1)		K2 R14 R24 R29 T30 R32 H33 Q37 I39 G44 V46 Q49 I65 K95 H97 G98 R99
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7m4z, PDBe:7m4z, PDBj:7m4z
PDBsum7m4z
PubMed34044590
UniProtB7IA23|RL18_ACIB5 Large ribosomal subunit protein uL18 (Gene Name=rplR)

[Back to BioLiP]