Structure of PDB 7m4y Chain N Binding Site BS02

Receptor Information

>7m4y Chain N (length=114) Species: 480119 (Acinetobacter baumannii AB0057)

EKKQSRLRRAKSTRLHIRALGATRLCVNRTPRHIYAQVISADGGKVLAQA
STLDASLRSGTTGNIEAATKVGALIAERAKAAGVTKVAFDRSGFKYHGRI
KALADAAREGGLEF

Ligand information

>7m4y Chain B (length=115)

gcuggcgaccauagcaagagugaaccaccugaucccuucccgaacucaga
agugaaaccucuuagcgcugaugguagugugggauuacccaugugagagu
aagucaucgccagcu

<<<<<<<<.....<<<<<<<.....<<<<<<...............>>>.
.>>>....>>>>>.>><<<.......<<<<<<<....>>>>>>>......
.>>>..>>>>>>>>.

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7m4y Cryo-EM Determination of Eravacycline-Bound Structures of the Ribosome and the Multidrug Efflux Pump AdeJ of Acinetobacter baumannii.
• Resolution: 2.5 Å
• Binding residue (original residue number in PDB): K4 K5 R26 R31 T32 R34 H35 Y37 Q39 G45 G46 Q51 R60 N66 H99 R101
• Binding residue (residue number reindexed from 1): K2 K3 R24 R29 T30 R32 H33 Y35 Q37 G43 G44 Q49 R58 N64 H97 R99

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008097 5S rRNA binding
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7m4y, PDBe:7m4y, PDBj:7m4y
• PDBsum: 7m4y
• PubMed: 34044590
• UniProt: B7IA23|RL18_ACIB5 Large ribosomal subunit protein uL18 (Gene Name=rplR)