Structure of PDB 7et3 Chain N Binding Site BS02

Receptor Information
>7et3 Chain N (length=65) Species: 10359 (Human betaherpesvirus 5) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AVFFEPHEENVLRCPERVLRRLLEDAAVTMRGGGWREDVLMDRVRKRYLR
QELRDLGHRVQTYCE
Ligand information
>7et3 Chain P (length=20) Species: 10359 (Human betaherpesvirus 5) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
LRQLAQSVQDTIQHMRFLYL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7et3 Structural basis for genome packaging, retention, and ejection in human cytomegalovirus.
Resolution4.2 Å
Binding residue
(original residue number in PDB)		L61 E64 L65 L68 R71
Binding residue
(residue number reindexed from 1)		L49 E52 L53 L56 R59
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0019072 viral genome packaging
GO:0019073 viral DNA genome packaging
GO:0046718 symbiont entry into host cell
GO:0075732 viral penetration into host nucleus
Cellular Component
GO:0019028 viral capsid
GO:0042025 host cell nucleus
GO:0043657 host cell

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7et3, PDBe:7et3, PDBj:7et3
PDBsum7et3
PubMed34315863
UniProtP16726|CVC2_HCMVA Capsid vertex component 2 (Gene Name=CVC2)

[Back to BioLiP]