Structure of PDB 6pep Chain N Binding Site BS02

Receptor Information
>6pep Chain N (length=139) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSGFVAKDDSLRTFFDAMALQLKEPVIVSKMAARKKITGNFEFHDPNALL
EKLSLQLGLIWYFDGQAIYIYDASEMRNAVVSLRNVSLNEFNNFLKRSGL
YNKNYPLRGDNRKGTFYVSGPPVYVDMVVNAATMMDKQN
Ligand information
>6pep Chain S (length=28) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
WLKGRSFQYGAEGYIKMSPGHWYFPSPL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6pep T3S injectisome needle complex structures in four distinct states reveal the basis of membrane coupling and assembly.
Resolution3.8 Å
Binding residue
(original residue number in PDB)
G32 S33 G34 F35 V36 D40 T44 A48
Binding residue
(residue number reindexed from 1)
G1 S2 G3 F4 V5 D9 T13 A17
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0009306 protein secretion

View graph for
Biological Process
External links
PDB RCSB:6pep, PDBe:6pep, PDBj:6pep
PDBsum6pep
PubMed31427728
UniProtP35672|SCTC1_SALTY SPI-1 type 3 secretion system secretin (Gene Name=sctC1)

[Back to BioLiP]