Structure of PDB 6oeo Chain N Binding Site BS02

Receptor Information
>6oeo Chain N (length=54) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTADDKQPYEKKAAKL
KEKY
Ligand information
>6oeo Chain I (length=46) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gatctggcctgtcttacacagtgatacagcccttaacaaaaacccg
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6oeo Cutting antiparallel DNA strands in a single active site.
Resolution3.69 Å
Binding residue
(original residue number in PDB)		A101 F102 G123 K127 G130 E131
Binding residue
(residue number reindexed from 1)		A1 F2 G23 K27 G30 E31
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6oeo, PDBe:6oeo, PDBj:6oeo
PDBsum6oeo
PubMed32015552
UniProtP09429|HMGB1_HUMAN High mobility group protein B1 (Gene Name=HMGB1)

[Back to BioLiP]