Structure of PDB 6oem Chain N Binding Site BS02

Receptor Information
>6oem Chain N (length=36) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PSAFFLFCSEYRPKIKGEHPGIGDVAKKLGEMWNNT
Ligand information
>6oem Chain J (length=57) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gatctggcctgtcttacacagtgatgcaaatcaagtgtgaagccagacaa
aaacccg
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6oem Cutting antiparallel DNA strands in a single active site.
Resolution3.6 Å
Binding residue
(original residue number in PDB)		F103 K114 P118 I122
Binding residue
(residue number reindexed from 1)		F5 K16 P20 I22
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6oem, PDBe:6oem, PDBj:6oem
PDBsum6oem
PubMed32015552
UniProtP09429|HMGB1_HUMAN High mobility group protein B1 (Gene Name=HMGB1)

[Back to BioLiP]