Structure of PDB 6nu2 Chain N Binding Site BS02

Receptor Information
>6nu2 Chain N (length=205) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KPKLRFIERAPLVPKVRREPKNLSDIRGPSTEATEFTEGNFAILALGGGY
LHWGHFEMMRLTINRSMDPKNMFAIWRVPAPFKPITRKSVGHRMGGGKGA
IDHYVTPVKAGRLVVEMGGRCEFEEVQGFLDQVAHKLPFAAKAVSRGTLE
KMRKDQEERERNNQNPWTFERIATANMLGIRKVLSPYDLTHKGKYWGKFY
MPKRV
Ligand information
>6nu2 Chain l (length=23) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SREYWRRLRKQNIWRHNRLSKNK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6nu2 Structural insights into unique features of the human mitochondrial ribosome recycling.
Resolution3.9 Å
Binding residue
(original residue number in PDB)		E168 E170 E171
Binding residue
(residue number reindexed from 1)		E122 E124 E125
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6nu2, PDBe:6nu2, PDBj:6nu2
PDBsum6nu2
PubMed30962385
UniProtQ9NX20|RM16_HUMAN Large ribosomal subunit protein uL16m (Gene Name=MRPL16)

[Back to BioLiP]