Structure of PDB 6gov Chain N Binding Site BS02

Receptor Information

>6gov Chain N (length=110) Species: 10710 (Lambdavirus lambda)

LGSMDAQTRRRERRAEKQAQWKAANPLLVGVSAKPVNRPILSLNRKPKSR
VESALNPIDLTVLAEYHKQIESNLQRIERKNQRTWYSKPGERGITCSGRQ
KIKGKSIPLI

Ligand information

>6gov Chain R (length=48)

cuuuaacauuaagcccugaagaagggcaaaaauaaaccagcguguggc

............<<<<<.....>>>>>.....................

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6gov Structural Basis for the Action of an All-Purpose Transcription Anti-termination Factor.
• Resolution: 3.7 Å
• Binding residue (original residue number in PDB): M1 D2 A3 Q4 R6 R7 R8 R10 R11 K14 W18 L25
• Binding residue (residue number reindexed from 1): M4 D5 A6 Q7 R9 R10 R11 R13 R14 K17 W21 L28

Gene Ontology

Molecular Function

• GO:0001000 bacterial-type RNA polymerase core enzyme binding
• GO:0001072 transcription antitermination factor activity, RNA binding
• GO:0003677 DNA binding
• GO:0003723 RNA binding
• GO:0003727 single-stranded RNA binding
• GO:0005515 protein binding
• GO:0035613 RNA stem-loop binding
• GO:0070063 RNA polymerase binding

Biological Process

• GO:0006353 DNA-templated transcription termination
• GO:0006357 regulation of transcription by RNA polymerase II
• GO:0031564 transcription antitermination
• GO:0032784 regulation of DNA-templated transcription elongation

External links

• PDB: RCSB:6gov, PDBe:6gov, PDBj:6gov
• PDBsum: 6gov
• PubMed: 30795892
• UniProt: P03045|REGN_LAMBD Antitermination protein N (Gene Name=N)