Structure of PDB 6cik Chain N Binding Site BS02

Receptor Information
>6cik Chain N (length=90) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FVQTCREEHKKKHPDASVNFSEFSKKCSERRPPSAFFLFCSEYRPKIKGE
HPGLSIGDVAKKLGEMWNNTDKQPYEKKAAKLKEKYEKDI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6cik Cracking the DNA Code for V(D)J Recombination.
Resolution3.15 Å
Binding residue
(original residue number in PDB)		F38 S42 S46 F103 I122
Binding residue
(residue number reindexed from 1)		F20 S24 S28 F37 I56
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6cik, PDBe:6cik, PDBj:6cik
PDBsum6cik
PubMed29628308
UniProtP09429|HMGB1_HUMAN High mobility group protein B1 (Gene Name=HMGB1)

[Back to BioLiP]