Structure of PDB 6cij Chain N Binding Site BS02

Receptor Information
>6cij Chain N (length=133) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKKEKGKFED
MAKADKARYEREKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIG
DVAKKLGEMWNNTAAKQPYEKKAAKLKEKYEKD
Ligand information
>6cij Chain M (length=41) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cacagtgatgcaaatcaagtgtgaagccagacaaaaacccg
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6cij Cracking the DNA Code for V(D)J Recombination.
Resolution3.9 Å
Binding residue
(original residue number in PDB)		S15 Y16 F38 S42 W49 R97 F103 I122
Binding residue
(residue number reindexed from 1)		S7 Y8 F30 S34 W41 R74 F80 I99
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6cij, PDBe:6cij, PDBj:6cij
PDBsum6cij
PubMed29628308
UniProtP09429|HMGB1_HUMAN High mobility group protein B1 (Gene Name=HMGB1)

[Back to BioLiP]