Structure of PDB 6cg0 Chain N Binding Site BS02

Receptor Information
>6cg0 Chain N (length=75) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SYAFFVQTCREEHKKKSVNFSEFSKKCSERWKKRPPSAFFLFCSEYRPKI
KGEHPGLSIGDVAKKLGEMWNNTAA
Ligand information
>6cg0 Chain M (length=41) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cacagtgatgcaaatcaagtgtgaagccagacaaaaacccg
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6cg0 Cracking the DNA Code for V(D)J Recombination.
Resolution3.17 Å
Binding residue
(original residue number in PDB)		Y16 F38 S42 S46 W49 K96 F103 R110 I122
Binding residue
(residue number reindexed from 1)		Y2 F20 S24 S28 W31 K33 F40 R47 I59
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6cg0, PDBe:6cg0, PDBj:6cg0
PDBsum6cg0
PubMed29628308
UniProtP09429|HMGB1_HUMAN High mobility group protein B1 (Gene Name=HMGB1)

[Back to BioLiP]