Structure of PDB 5ze0 Chain N Binding Site BS02

Receptor Information
>5ze0 Chain N (length=118) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKAKEKGKFED
MAKADKARYEREMKRPPSAFFLFCSEYRPKIKGEIGDVAKKLGEMWNNTD
DKQPYEKKAAKLKEKYEK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ze0 Cracking the DNA Code for V(D)J Recombination
Resolution2.75 Å
Binding residue
(original residue number in PDB)		S14 Y16 F38 S39 S42 K43 W49 F103
Binding residue
(residue number reindexed from 1)		S5 Y7 F29 S30 S33 K34 W40 F71
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:5ze0, PDBe:5ze0, PDBj:5ze0
PDBsum5ze0
PubMed29628308
UniProtP63158|HMGB1_MOUSE High mobility group protein B1 (Gene Name=Hmgb1)

[Back to BioLiP]