Structure of PDB 5zdz Chain N Binding Site BS02

Receptor Information
>5zdz Chain N (length=117) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKAKEKGKFEDM
AKADKARYEREMKRPPSAFFLFCSEYRPKIKGEIGDVAKKLGEMWNNTDD
KQPYEKKAAKLKEKYEK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5zdz Cracking the DNA Code for V(D)J Recombination
Resolution2.8 Å
Binding residue
(original residue number in PDB)		S14 Y16 F38 S42 K43 S46 W49 F103 I122
Binding residue
(residue number reindexed from 1)		S4 Y6 F28 S32 K33 S36 W39 F70 I84
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:5zdz, PDBe:5zdz, PDBj:5zdz
PDBsum5zdz
PubMed29628308
UniProtP63158|HMGB1_MOUSE High mobility group protein B1 (Gene Name=Hmgb1)

[Back to BioLiP]