Structure of PDB 5no6 Chain N Binding Site BS02

Receptor Information
>5no6 Chain N (length=73) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EGVWSPDIEQSFQEALAIYPPCGRRKIILSDEGKMYGRNELIARYIKLRT
GKTRTRKQVSSHIQVLARRKARE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5no6 TEAD4-HOXB13 complex bound to DNA
Resolution2.88 Å
Binding residue
(original residue number in PDB)
G76 N78 E79 R95 S99 Q103
Binding residue
(residue number reindexed from 1)
G37 N39 E40 R56 S60 Q64
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:5no6, PDBe:5no6, PDBj:5no6
PDBsum5no6
PubMed
UniProtQ15561|TEAD4_HUMAN Transcriptional enhancer factor TEF-3 (Gene Name=TEAD4)

[Back to BioLiP]