Structure of PDB 5clv Chain N Binding Site BS02

Receptor Information

>5clv Chain N (length=64) Species: 562 (Escherichia coli)

KKRLTESQFQEAIQGLEVGQQTIEIARGVLVDGKPQATFATSLGLTRGAV
SQAVHRVWAAFEDK

Ligand information

>5clv Chain P (length=20)

ccaagtttagctaaacttgg

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5clv Flexibility of KorA, a plasmid-encoded, global transcription regulator, in the presence and the absence of its operator.
• Resolution: 2.5 Å
• Binding residue (original residue number in PDB): V19 G20 T23 L46 T47 A50 Q53 R57
• Binding residue (residue number reindexed from 1): V18 G19 T22 L45 T46 A49 Q52 R56

External links

• PDB: RCSB:5clv, PDBe:5clv, PDBj:5clv
• PDBsum: 5clv
• PubMed: 27016739
• UniProt: P03052|KORA2_ECOLX TrfB transcriptional repressor protein (Gene Name=trfB)