Structure of PDB 4ynl Chain N Binding Site BS02

Receptor Information
>4ynl Chain N (length=76) Species: 103690 (Nostoc sp. PCC 7120 = FACHB-418) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ERTYIMVEDTARYFRMMKDWAEKRPNAMRALEELDVPPERWDEAMQELDE
IIRTWADKYHQVGGIPMILQMVFGRK
Ligand information
>4ynl Chain R (length=6) Species: 103690 (Nostoc sp. PCC 7120 = FACHB-418) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ERGSGR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4ynl Structural insights into HetR-PatS interaction involved in cyanobacterial pattern formation
Resolution2.1 Å
Binding residue
(original residue number in PDB)		D270 I273 A277 H281
Binding residue
(residue number reindexed from 1)		D49 I52 A56 H60
Enzymatic activity
Enzyme Commision number 3.4.21.-
External links
PDB RCSB:4ynl, PDBe:4ynl, PDBj:4ynl
PDBsum4ynl
PubMed26576507
UniProtP27709|HETR_NOSS1 DNA-binding transcriptional activator HetR (Gene Name=hetR)

[Back to BioLiP]