Structure of PDB 4csf Chain N Binding Site BS02

Receptor Information
>4csf Chain N (length=249) Species: 11590 (Toscana virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ENYRDIALAFLDESADSGTINAWVNEFAYQGFDPKRIVQLVKERGTAKGR
DWKKDVKMMIVLNLVRGNKPEAMMKKMSEKGASIVANLISVYQLKEGNPG
RDTITLSRVSAAFVPWTVQALRVLSESLPVSGTTMDAIAGVTYPRAMMHP
SFAGIIDLDLPNGAGATIADAHGLFMIEFSKTINPSLRTKQANEVAATFE
KPNMAAMSGRFFTREDKKKLLIAVGIIDEDLVLASAVVRSAEKYRAKVG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4csf Structural Insights Into RNA Encapsidation and Helical Assembly of the Toscana Virus Nucleoprotein.
Resolution2.598 Å
Binding residue
(original residue number in PDB)		K79 T185 I186
Binding residue
(residue number reindexed from 1)		K76 T182 I183
Binding affinityPDBbind-CN: Kd=260nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0019013 viral nucleocapsid
GO:0019029 helical viral capsid
GO:0030430 host cell cytoplasm
GO:0042025 host cell nucleus
GO:0044172 host cell endoplasmic reticulum-Golgi intermediate compartment
GO:0044177 host cell Golgi apparatus
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:4csf, PDBe:4csf, PDBj:4csf
PDBsum4csf
PubMed24688060
UniProtP21701|NCAP_TOSV Nucleoprotein (Gene Name=N)

[Back to BioLiP]