Structure of PDB 2qa4 Chain N Binding Site BS02

Receptor Information
>2qa4 Chain N (length=186) Species: 2238 (Haloarcula marismortui) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ATGPRYKVPMRRRREARTDYHQRLRLLKSGKPRLVARKSNKHVRAQLVTL
GPNGDDTLASAHSSDLAEYGWEAPTGNMPSAYLTGLLAGLRAQEAGVEEA
VLDIGLNSPTPGSKVFAIQEGAIDAGLDIPHNDDVLADWQRTRGAHIAEY
DEQLEEPLYSGDFDAADLPEHFDELRETLLDGDIEL
Ligand information
>2qa4 Chain 9 (length=122) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uuaggcggccacagcggugggguugccucccguacccaucccgaacacgg
aagauaagcccaccagcguuccggggaguacuggagugcgcgagccucug
ggaaacccgguucgccgccacc
...<<<<<<....<<<<<<<<......<<<<<<.............>>>>
..>>....>>>>>>.>><..<<<<<.....<<<<<<.<<....>>>>>>>
>....>>>>>.>.>>>>>>...
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2qa4 Structure of the base of the L7/L12 stalk of the Haloarcula marismortui large ribosomal subunit: Analysis of L11 movements
Resolution3.0 Å
Binding residue
(original residue number in PDB)		A1 G3 P4 V8 M10 R11 R12 R14 R17 T18 Y20 R23 R33 V35 R37 S39 N40 H42 R44 Q46 V48 N53 G54 D55 D56 T57 N77 M78 S108 T110 P111 S113 K114 R141 H146 I147 Y150 Q153 Y159 S160
Binding residue
(residue number reindexed from 1)		A1 G3 P4 V8 M10 R11 R12 R14 R17 T18 Y20 R23 R33 V35 R37 S39 N40 H42 R44 Q46 V48 N53 G54 D55 D56 T57 N77 M78 S108 T110 P111 S113 K114 R141 H146 I147 Y150 Q153 Y159 S160
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2qa4, PDBe:2qa4, PDBj:2qa4
PDBsum2qa4
PubMed17599351
UniProtP14123|RL18_HALMA Large ribosomal subunit protein uL18 (Gene Name=rpl18)

[Back to BioLiP]