Structure of PDB 2as5 Chain N Binding Site BS02

Receptor Information

>2as5 Chain N (length=287) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ASLPPLEWPLSSQSGSYELRIEVQPKPHHRAHYETEGSRGAVKAPTGGHP
VVQLHGYMENKPLGLQIFIGTADERILKPHAFYQVHRITGKTVTTTSYEK
IVGNTKVLEIPLEPKNNMRATIDCAGILKLRNADIELRKGETDIGRKNTR
VRLVFRVHIPESSGRIVSLQTASNPIECSQRSAHELPMVERQDTDSCLVY
GGQQMILTGQNFTSESKVVFTEKTTDGQQIWEMEATVDKDKSQPNMLFVE
IPEYRNKHIRTPVKVNFYVINGKRKRSQPQHFTYHPV

Ligand information

>2as5 Chain B (length=21) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aactatgaaacaaattttcct

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2as5 FOXP3 Controls Regulatory T Cell Function through Cooperation with NFAT.
Resolution	2.7 Å
Binding residue (original residue number in PDB)	Y424 T426 K520 R522 N523 K538 R572 R665
Binding residue (residue number reindexed from 1)	Y33 T35 K129 R131 N132 K147 R181 R274

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:2as5, PDBe:2as5, PDBj:2as5
PDBsum	2as5
PubMed	16873067
UniProt	Q13469\|NFAC2_HUMAN Nuclear factor of activated T-cells, cytoplasmic 2 (Gene Name=NFATC2)

[Back to BioLiP]