Structure of PDB 1c9b Chain N Binding Site BS02

Receptor Information
>1c9b Chain N (length=180) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREP
RTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQN
MVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVS
GKVVLTGAKVRAEIYEAFENIYPILKGFRK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1c9b Structural basis of preinitiation complex assembly on human pol II promoters.
Resolution2.65 Å
Binding residue
(original residue number in PDB)		Q166 N167 F197 R203 T210 L212 T222 P289 F305 S307 K309 V311
Binding residue
(residue number reindexed from 1)		Q9 N10 F40 R46 T53 L55 T65 P132 F148 S150 K152 V154
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006352 DNA-templated transcription initiation

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1c9b, PDBe:1c9b, PDBj:1c9b
PDBsum1c9b
PubMed10619841
UniProtP20226|TBP_HUMAN TATA-box-binding protein (Gene Name=TBP)

[Back to BioLiP]