Structure of PDB 1a02 Chain N Binding Site BS02

Receptor Information

>1a02 Chain N (length=280) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

WPLSSQSGSYELRIEVQPKPHHRAHYETEGSRGAVKAPTGGHPVVQLHGY
MENKPLGLQIFIGTADERILKPHAFYQVHRITGKTVTTTSYEKIVGNTKV
LEIPLEPKNNMRATIDCAGILKLRNADIELRKGETDIGRKNTRVRLVFRV
HIPESSGRIVSLQTASNPIECSQRSAHELPMVERQDTDSCLVYGGQQMIL
TGQNFTSESKVVFTEKTTDGQQIWEMEATVDKDKSQPNMLFVEIPEYRNK
HIRTPVKVNFYVINGKRKRSQPQHFTYHPV

Ligand information

>1a02 Chain B (length=20) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aactatgaaacaaattttcc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1a02 Structure of the DNA-binding domains from NFAT, Fos and Jun bound specifically to DNA.
Resolution	2.7 Å
Binding residue (original residue number in PDB)	Y424 T426 R522 N523 R537 K538 R572 R665
Binding residue (residue number reindexed from 1)	Y26 T28 R124 N125 R139 K140 R174 R267

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:1a02, PDBe:1a02, PDBj:1a02
PDBsum	1a02
PubMed	9510247
UniProt	Q13469\|NFAC2_HUMAN Nuclear factor of activated T-cells, cytoplasmic 2 (Gene Name=NFATC2)

[Back to BioLiP]