Structure of PDB 8b2l Chain M1 Binding Site BS02

Receptor Information
>8b2l Chain M1 (length=52) Species: 4097 (Nicotiana tabacum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GKVHGSLARAGKVRGQTPKVAKQDKKKKPRGRAHKRMQYNRRFVTARGPN
SS
Ligand information
>8b2l Chain i2 (length=76) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcggggauagcucaguugggagagcgucagacugaagaucugaaggucgc
guguucgauccacgcucaccgcacca
<<<<.<<..<<<<........>>>>.<<<<<.......>>>>>.....<<
<<<.......>>>>>>>.>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8b2l Structure of the actively translating plant 80S ribosome at 2.2 angstrom resolution.
Resolution2.2 Å
Binding residue
(original residue number in PDB)		G2 K3 H5
Binding residue
(residue number reindexed from 1)		G1 K2 H4
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005829 cytosol
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8b2l, PDBe:8b2l, PDBj:8b2l
PDBsum8b2l
PubMed37156858
UniProtA0A1S3XGJ0

[Back to BioLiP]