Structure of PDB 7r81 Chain M1 Binding Site BS02

Receptor Information
>7r81 Chain M1 (length=165) Species: 5141 (Neurospora crassa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PMRELRIQKLVLNICVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTF
GIRRNEKISVHVTVRGPKAEEILERGLKVKEYELRKRNFSETGNFGFGIS
EHIDLGIKYDPGIGIYGMDFYCCMTRPGERVSRRRRAKSRVGATHRITRD
DTVKWFKSRFDAIVR
Ligand information
>7r81 Chain B1 (length=120) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
acauacgaccauacccacuggaaaacucgggaucccguccgcucucccau
agauaagccagugagggccagacuaguaguugggucggugacgaccagcg
aaucccugguguuguauguu
<<<<<<<<<....<<<<<<<<.....<<<<<<............>>>>..
.>>....>>>>>>.>><<<<<.......<<<<<..<<....>>.>>>>>.
.....>>>>>>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7r81 Structure of the translating Neurospora ribosome arrested by cycloheximide
Resolution2.7 Å
Binding residue
(original residue number in PDB)
M11 Q45 T46 V48 T72 R74 R139 V140 R143 R145 S148 R149 G151 A152 H154
Binding residue
(residue number reindexed from 1)
M2 Q36 T37 V39 T63 R65 R130 V131 R134 R136 S139 R140 G142 A143 H145
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7r81, PDBe:7r81, PDBj:7r81
PDBsum7r81
PubMed34815343
UniProtQ7RVN0|RL11_NEUCR Large ribosomal subunit protein uL5 (Gene Name=rpl-11)

[Back to BioLiP]