Structure of PDB 8y36 Chain M Binding Site BS02

Receptor Information
>8y36 Chain M (length=119) Species: 1280 (Staphylococcus aureus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MISKIDKNKVRLKRHARVRTNLSGTAEKPRLNVYRSNKHIYAQIIDDNKG
VTLAQASSKDSDIATTATKVELATKVGEAIAKKAADKGIKEIVFDRGGYL
YHGRVKALAEAARESGLEF
Ligand information
>8y36 Chain B (length=115) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ucuggugacuauagcaaggaggucacaccuguucccaugccgaacacaga
aguuaagcuccuuagcgucgaugguagucgaacuuacguuccgcuagagu
agaacguugccaggc
<<<<<<<<<....<<<<<<<<.....<<<<<<.............>>>>.
.>>....>>>>>>.>>.<<......<<<.<<<<....>>>>.>>>.....
.>>..>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8y36 Synthetic macrolides overcoming MLS B K-resistant pathogens.
Resolution2.65 Å
Binding residue
(original residue number in PDB)		K4 D6 K7 R11 R19 R30 N32 Y34 R35 S36 N37 H39 Q43 T52 Q55 K59 A67 T68 K69 V70 H102 G103 R104
Binding residue
(residue number reindexed from 1)		K4 D6 K7 R11 R19 R30 N32 Y34 R35 S36 N37 H39 Q43 T52 Q55 K59 A67 T68 K69 V70 H102 G103 R104
Gene Ontology
Molecular Function
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8y36, PDBe:8y36, PDBj:8y36
PDBsum8y36
PubMed38992047
UniProtQ7A085|RL18_STAAW Large ribosomal subunit protein uL18 (Gene Name=rplR)

[Back to BioLiP]