Structure of PDB 8uh4 Chain M Binding Site BS02

Receptor Information
>8uh4 Chain M (length=213) Species: 10823 (Maize streak virus - [Nigeria]) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AGSKADRPSLQIQTLQHAGTTMITVPSGGVCDLINTYARGSDEGNRHTSE
TLTYKIAIDYHFVADAAACRYSNTGTGVMWLVYDTTPGGQAPTPQTIFAY
PDTLKAWPATWKVSRELCHRFVVKRRWLFNMETDGRIGSDIPPSNASWKP
CKRNIYFHKFTSGLGVRTQWKNVTDGGVGAIQRGALYMVIAPGNGLTFTA
HGQTRLYFKSVGN
Ligand information
>8uh4 Chain AN (length=9) Species: 10823 (Maize streak virus - [Nigeria]) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aaaatccca
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8uh4 The Two States of MSV Gemini Capsid Assembly
Resolution3.72 Å
Binding residue
(original residue number in PDB)		K34 R145 H149 R155
Binding residue
(residue number reindexed from 1)		K4 R115 H119 R125
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005198 structural molecule activity
Biological Process
GO:0046718 symbiont entry into host cell
GO:0075732 viral penetration into host nucleus
Cellular Component
GO:0019028 viral capsid
GO:0039615 T=1 icosahedral viral capsid
GO:0042025 host cell nucleus
GO:0043657 host cell

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8uh4, PDBe:8uh4, PDBj:8uh4
PDBsum8uh4
PubMed
UniProtP06448|CAPSD_MSVN Capsid protein (Gene Name=V1)

[Back to BioLiP]