Structure of PDB 8r08 Chain M Binding Site BS02

Receptor Information
>8r08 Chain M (length=123) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIV
MAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVT
IKEGSQLKQQIQSIQQSIERLLV
Ligand information
>8r08 Chain 6 (length=53) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uuggaaaagauuagcauggccccugcgcaaggaugacuucgugaagcgau
uuu
..................................................
...
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8r08 Structural insights into the cross-exon to cross-intron spliceosome switch
Resolution6.1 Å
Binding residue
(original residue number in PDB)		Q111 L112
Binding residue
(residue number reindexed from 1)		Q106 L107
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0030515 snoRNA binding
GO:0030621 U4 snRNA binding
GO:0030622 U4atac snRNA binding
GO:0034511 U3 snoRNA binding
GO:0034512 box C/D sno(s)RNA binding
GO:0051117 ATPase binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0000492 box C/D snoRNP assembly
GO:0006397 mRNA processing
GO:0007338 single fertilization
GO:0008380 RNA splicing
GO:0030490 maturation of SSU-rRNA
GO:0042274 ribosomal small subunit biogenesis
Cellular Component
GO:0001651 dense fibrillar component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005690 U4atac snRNP
GO:0005730 nucleolus
GO:0031428 box C/D methylation guide snoRNP complex
GO:0032040 small-subunit processome
GO:0032991 protein-containing complex
GO:0046540 U4/U6 x U5 tri-snRNP complex
GO:0071005 U2-type precatalytic spliceosome
GO:0071011 precatalytic spliceosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8r08, PDBe:8r08, PDBj:8r08
PDBsum8r08
PubMed38778104
UniProtP55769|NH2L1_HUMAN NHP2-like protein 1 (Gene Name=SNU13)

[Back to BioLiP]