Structure of PDB 8q7n Chain M Binding Site BS02

Receptor Information
>8q7n Chain M (length=124) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFI
VMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSV
TIKEGSQLKQQIQSIQQSIERLLV
Ligand information
>8q7n Chain 4 (length=76) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
agcuuugcgcaguggcaguaucguagccaaugagguuuauccgaggcgcg
auuauugcuaauacuuuucccaauac
...................<<<<<.<<<.....<<.....>>..>>>>>>
>>........................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8q7n New insights into the functions of B complex proteins revealed by cryo-EM of dimerized spliceosomes
Resolution3.1 Å
Binding residue
(original residue number in PDB)		N31 Y32 R36 K37 G38 A39 N40 E41 K44 R48 A60 K86 V95 R97 V99 I100 Q111
Binding residue
(residue number reindexed from 1)		N27 Y28 R32 K33 G34 A35 N36 E37 K40 R44 A56 K82 V91 R93 V95 I96 Q107
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0030515 snoRNA binding
GO:0030621 U4 snRNA binding
GO:0030622 U4atac snRNA binding
GO:0034511 U3 snoRNA binding
GO:0034512 box C/D sno(s)RNA binding
GO:0051117 ATPase binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0000492 box C/D snoRNP assembly
GO:0006397 mRNA processing
GO:0007338 single fertilization
GO:0008380 RNA splicing
GO:0030490 maturation of SSU-rRNA
GO:0042254 ribosome biogenesis
GO:0042274 ribosomal small subunit biogenesis
Cellular Component
GO:0001651 dense fibrillar component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005690 U4atac snRNP
GO:0005730 nucleolus
GO:0031428 box C/D methylation guide snoRNP complex
GO:0032040 small-subunit processome
GO:0032991 protein-containing complex
GO:0046540 U4/U6 x U5 tri-snRNP complex
GO:0071005 U2-type precatalytic spliceosome
GO:0071011 precatalytic spliceosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8q7n, PDBe:8q7n, PDBj:8q7n
PDBsum8q7n
PubMed38383864
UniProtP55769|NH2L1_HUMAN NHP2-like protein 1 (Gene Name=SNU13)

[Back to BioLiP]