Structure of PDB 8ox1 Chain M Binding Site BS02

Receptor Information
>8ox1 Chain M (length=65) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HRARKRQAWLWEEDKNLRSGVRKYGEGNWSKILLHYKFNNRTSVMLKDRW
RTMKKLKLISSDSED
Ligand information
>8ox1 Chain J (length=145) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcttagggttagggttagggttagggttagggttagggttagggttagg
gttagggttagggttagggttagggttagggttagggttagggttagggt
tagggttagggttagggttagggttagggttagggttagggtgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ox1 Structural basis of telomeric nucleosome recognition by shelterin factor TRF1.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		G401 W403 K421 R425
Binding residue
(residue number reindexed from 1)		G27 W29 K47 R51
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003691 double-stranded telomeric DNA binding
GO:0003720 telomerase activity
GO:0005515 protein binding
GO:0008017 microtubule binding
GO:0008301 DNA binding, bending
GO:0042162 telomeric DNA binding
GO:0042802 identical protein binding
GO:0042803 protein homodimerization activity
GO:0071532 ankyrin repeat binding
GO:0098505 G-rich strand telomeric DNA binding
Biological Process
GO:0000723 telomere maintenance
GO:0007004 telomere maintenance via telomerase
GO:0008156 negative regulation of DNA replication
GO:0016233 telomere capping
GO:0032206 positive regulation of telomere maintenance
GO:0032211 negative regulation of telomere maintenance via telomerase
GO:0032214 negative regulation of telomere maintenance via semi-conservative replication
GO:0045141 meiotic telomere clustering
GO:0051301 cell division
GO:0061820 telomeric D-loop disassembly
GO:0090656 t-circle formation
GO:1904357 negative regulation of telomere maintenance via telomere lengthening
GO:1904792 positive regulation of shelterin complex assembly
GO:1904850 negative regulation of establishment of protein localization to telomere
GO:1904911 negative regulation of establishment of RNA localization to telomere
GO:1904914 negative regulation of establishment of protein-containing complex localization to telomere
GO:1905778 negative regulation of exonuclease activity
GO:1905839 negative regulation of telomeric D-loop disassembly
Cellular Component
GO:0000781 chromosome, telomeric region
GO:0000783 nuclear telomere cap complex
GO:0001650 fibrillar center
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005819 spindle
GO:0005856 cytoskeleton
GO:0016604 nuclear body
GO:0070187 shelterin complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ox1, PDBe:8ox1, PDBj:8ox1
PDBsum8ox1
PubMed37624885
UniProtP54274|TERF1_HUMAN Telomeric repeat-binding factor 1 (Gene Name=TERF1)

[Back to BioLiP]