Structure of PDB 8i0w Chain M Binding Site BS02

Receptor Information

>8i0w Chain M (length=91) Species: 9606 (Homo sapiens)

KKKRKNPDLGFSDYAAAQLRQYHRLTKQIKPDMETYERLREKHGEEFFPT
SNSLLHGTHVPSTEEIDRMVIDLEKQIEKRDKYSRRRPYND

Ligand information

>8i0w Chain H (length=139)

aucgcuucucggccuuuuggcuaagaucaaguguaguaucuguucuuuua
auauguccucuaccgaggacaauauuaaggauuuuuggagcagggagcca
cgcaucgaccugguauugcaguaccuccaggaacggugc

...............................................<<<
<<<<<<<<<<....>>>>>>.>>>>>>>...............<......
><<<<<<.<<<<<.............>>>>>..>>>>>>

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8i0w Molecular basis for the activation of human spliceosome
• Resolution: 3.4 Å
• Binding residue (original residue number in PDB): Y196 S197 R198 R200 P201
• Binding residue (residue number reindexed from 1): Y83 S84 R85 R87 P88

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0005515 protein binding

Biological Process

• GO:0000398 mRNA splicing, via spliceosome
• GO:0001701 in utero embryonic development
• GO:0006397 mRNA processing
• GO:0007095 mitotic G2 DNA damage checkpoint signaling
• GO:0007369 gastrulation
• GO:0008284 positive regulation of cell population proliferation
• GO:0008380 RNA splicing
• GO:0048568 embryonic organ development

Cellular Component

• GO:0000974 Prp19 complex
• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005681 spliceosomal complex
• GO:0016607 nuclear speck
• GO:0071007 U2-type catalytic step 2 spliceosome
• GO:0071013 catalytic step 2 spliceosome
• GO:0071014 post-mRNA release spliceosomal complex

External links

• PDB: RCSB:8i0w, PDBe:8i0w, PDBj:8i0w
• PDBsum: 8i0w
• PubMed: 39068178
• UniProt: O95926|SYF2_HUMAN Pre-mRNA-splicing factor SYF2 (Gene Name=SYF2)