Structure of PDB 8c6j Chain M Binding Site BS02

Receptor Information
>8c6j Chain M (length=289) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ADFPILCQTCLGENPYIRMTKEKYGKECKICARPFTVFRWCPGVRMRFKK
TEVCQTCSKLKNVCQTCLLDLEYGLPIQVRDAGLSFKDDMPKSDVNKEYY
TQNMEREISNSDGTRPVGMLGKATSTSDMLLKLARTTPYYKRNRPHICSF
WVKGECKRGEECPYRHEKPTDPDDPLADQNIKDRYYGINDPVADKLLKRA
STMPRLDPPEDKTITTLYVGGLGDTITETDLRNHFYQFGEIRTITVVQRQ
QCAFIQFATRQAAEVAAEKSFNKLIVNGRRLNVKWGRSQ
Ligand information
>8c6j Chain I (length=84) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
guauguaucaagcuuacaagacugauucuuauguauuuacugaccugugu
uuuuuugcuacuuuuuuucuuuucuccccuuccc
..................................................
..................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8c6j Regulation of 3' splice site selection after step 1 of splicing by spliceosomal C* proteins.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		K46 R64 K66 K67 E69 T83 C84 G91 R152 Y156 R159 H163 L193 A194 Q196 I198 R201 K212 L213
Binding residue
(residue number reindexed from 1)		K29 R47 K49 K50 E52 T66 C67 G74 R135 Y139 R142 H146 L176 A177 Q179 I181 R184 K195 L196
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0017070 U6 snRNA binding
GO:0036002 pre-mRNA binding
GO:0046872 metal ion binding
GO:0048306 calcium-dependent protein binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0033120 positive regulation of RNA splicing
GO:0042307 positive regulation of protein import into nucleus
GO:0045292 mRNA cis splicing, via spliceosome
GO:0046827 positive regulation of protein export from nucleus
GO:0071466 cellular response to xenobiotic stimulus
Cellular Component
GO:0000974 Prp19 complex
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005737 cytoplasm
GO:0071006 U2-type catalytic step 1 spliceosome
GO:0071007 U2-type catalytic step 2 spliceosome
GO:0071013 catalytic step 2 spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8c6j, PDBe:8c6j, PDBj:8c6j
PDBsum8c6j
PubMed36867703
UniProtQ9NW64|RBM22_HUMAN Pre-mRNA-splicing factor RBM22 (Gene Name=RBM22)

[Back to BioLiP]