Structure of PDB 8am9 Chain M Binding Site BS02

Receptor Information
>8am9 Chain M (length=123) Species: 679895 (Escherichia coli BW25113) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ATVNQLVRKPRARKVAKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRK
VCRVRLTNGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGA
LDCSGVKDRKQARSKYGVKRPKA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8am9 Structural basis for translation inhibition by the glycosylated drosocin peptide.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		K44 P45
Binding residue
(residue number reindexed from 1)		K43 P44
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
GO:0034336 misfolded RNA binding
Biological Process
GO:0000372 Group I intron splicing
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0033120 positive regulation of RNA splicing
GO:0034337 RNA folding
GO:0046677 response to antibiotic
GO:1990145 maintenance of translational fidelity
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8am9, PDBe:8am9, PDBj:8am9
PDBsum8am9
PubMed36997646
UniProtP0A7S3|RS12_ECOLI Small ribosomal subunit protein uS12 (Gene Name=rpsL)

[Back to BioLiP]