Structure of PDB 7u0i Chain M Binding Site BS02

Receptor Information
>7u0i Chain M (length=75) Species: 9606,83333 [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEA
LQLSFKNMCKLRPLLQKWVEEADNN
Ligand information
>7u0i Chain J (length=149) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ctttattcacaagcttgcacaatccctgctggacaattctgagtgatggc
agctcccacctttccttcttccttcacttagactacatttattcagcatc
tgtattgttggagtaagttccatgttaatactcaccactgaggatatgt
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7u0i Structural mechanism of LIN28B nucleosome targeting by OCT4.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		R157 T163 Q164 Q181 T182 R186
Binding residue
(residue number reindexed from 1)		R18 T24 Q25 Q42 T43 R47
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0015144 carbohydrate transmembrane transporter activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0008643 carbohydrate transport
GO:0055085 transmembrane transport

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7u0i, PDBe:7u0i, PDBj:7u0i
PDBsum7u0i
PubMed37327775
UniProtP0AEX9|MALE_ECOLI Maltose/maltodextrin-binding periplasmic protein (Gene Name=malE);
Q01860|PO5F1_HUMAN POU domain, class 5, transcription factor 1 (Gene Name=POU5F1)

[Back to BioLiP]