Structure of PDB 7k7g Chain M Binding Site BS02

Receptor Information
>7k7g Chain M (length=43) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TQLKSKHPCSVCTRRKVKCDRMIPCGNCRKRGQDSECMKSTKL
Ligand information
>7k7g Chain J (length=123) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ttcttactatttcttttttaactttcggaaatcaaatacactaatattaa
aacgcgggggacagcgcgtacgtgcgtttaagcggtgctagagctgtcta
cgaccaattgagcggcctcggca
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7k7g Structural and dynamic mechanisms of CBF3-guided centromeric nucleosome formation.
Resolution4.2 Å
Binding residue
(original residue number in PDB)		R20 K21
Binding residue
(residue number reindexed from 1)		R15 K16
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0008270 zinc ion binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7k7g, PDBe:7k7g, PDBj:7k7g
PDBsum7k7g
PubMed33741944
UniProtP40969|CBF3B_YEAST Centromere DNA-binding protein complex CBF3 subunit B (Gene Name=CEP3)

[Back to BioLiP]