Structure of PDB 6rwe Chain M Binding Site BS02

Receptor Information
>6rwe Chain M (length=392) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SEIEIESVQDQPSVAVGSFFKGFRAPSDTTFDLYKKKKSEKDEFVLHGEN
ERLEYEGYTDSSSQASNQYVVGLFNPEKKSIQLYKAPVLVSKVVSKSSKN
LRGPKIKSKSDTRPSALRNALGEAFGTKKAKKAIADLERNRIDSDKLTDS
AIDIVDSVRTASKDLPTRAQLDEITDRPTPLANIDATDVEQIYPIESIIP
KKELQFIRVSSILKEADKEKKLELFPYQNNSKYVAKKLDSLTQPSQMTKL
QLLYYLSLLLGVYENRRVNNKTKLLERLNSPPEILVDGILSRFTVIKPGQ
FGRSKDRSYFIDPQNEDKILCYILAIIMHLDNFIVEITPLAHELNLKPSK
VVSLFRVLGAIVKGATVAQAEAFGIPKSTAASYKIATMKVPF
Ligand information
>6rwe Chain U (length=45) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tggagtacaagtgtgaggaaaagtagttggcggaagtaaagcagt
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6rwe Molecular insight into RNA polymerase I promoter recognition and promoter melting.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		P385 K386 S387
Binding residue
(residue number reindexed from 1)		P376 K377 S378
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0001054 RNA polymerase I activity
GO:0003677 DNA binding
GO:0016779 nucleotidyltransferase activity
Biological Process
GO:0001188 RNA polymerase I preinitiation complex assembly
GO:0006351 DNA-templated transcription
GO:0006360 transcription by RNA polymerase I
GO:0006361 transcription initiation at RNA polymerase I promoter
GO:0006362 transcription elongation by RNA polymerase I
GO:0006363 termination of RNA polymerase I transcription
GO:0008361 regulation of cell size
GO:0042254 ribosome biogenesis
GO:0042790 nucleolar large rRNA transcription by RNA polymerase I
Cellular Component
GO:0000428 DNA-directed RNA polymerase complex
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005736 RNA polymerase I complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6rwe, PDBe:6rwe, PDBj:6rwe
PDBsum6rwe
PubMed31804486
UniProtQ01080|RPA49_YEAST DNA-directed RNA polymerase I subunit RPA49 (Gene Name=RPA49)

[Back to BioLiP]