Structure of PDB 6qx2 Chain M Binding Site BS02

Receptor Information

>6qx2 Chain M (length=189) Species: 1280 (Staphylococcus aureus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

KLADCSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAILPLRGKILNVEK
ARLDRILNNNEIRQMITAFGTGIGGDFDLAKARYHKIVIMTDADVDGAHI
RTLLLTFFYRFMRPLIEAGYVYIAQPPTGYKGLGEMNADQLWETTMNPEH
RALLQVKLEDAIEADQTFEMLMGDVVENRRQFIEDNAVY

Ligand information

>6qx2 Chain O (length=20) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gagcgtacggccgtacgctt

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6qx2 Structure-guided design of antibacterials that allosterically inhibit DNA gyrase.
Resolution	3.4 Å
Binding residue (original residue number in PDB)	D437 G459 D512
Binding residue (residue number reindexed from 1)	D21 G43 D96

Enzymatic activity

Enzyme Commision number

5.6.2.2: DNA topoisomerase (ATP-hydrolyzing).

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003918	DNA topoisomerase type II (double strand cut, ATP-hydrolyzing) activity
GO:0005524	ATP binding

	Biological Process
GO:0006265	DNA topological change

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:6qx2, PDBe:6qx2, PDBj:6qx2
PDBsum	6qx2
PubMed	30962087
UniProt	P0A0K8\|GYRB_STAAU DNA gyrase subunit B (Gene Name=gyrB)

[Back to BioLiP]