Structure of PDB 6qdv Chain M Binding Site BS02

Receptor Information
>6qdv Chain M (length=289) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ADFPILCQTCLGENPYIRMTKEKYGKECKICARPFTVFRWCPGVRMRFKK
TEVCQTCSKLKNVCQTCLLDLEYGLPIQVRDAGLSFKDDMPKSDVNKEYY
TQNMEREISNSDGTRPVGMLGKATSAAAALLKLARTTPYYKRNRPHICSF
WVKGECKRGEECPYRHEKPTDPDDPLADQNIKDRYYGINDPVADKLLKRA
STMPRLDPPEDKTITTLYVGGLGDTITETDLRNHFYQFGEIRTITVVQRQ
QCAFIQFATRQAAEVAAEKSFNKLIVNGRRLNVKWGRSQ
Ligand information
>6qdv Chain I (length=42) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
guaagagccuagcauguagaaugaugucauacuuauccucag
..........................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6qdv A human postcatalytic spliceosome structure reveals essential roles of metazoan factors for exon ligation.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		K46 R64 K66 K67 E69 T83 C84 G91 L92 R152 Y156 R159 H163 T187 L193 Q196 I198 R201 L213 R216
Binding residue
(residue number reindexed from 1)		K29 R47 K49 K50 E52 T66 C67 G74 L75 R135 Y139 R142 H146 T170 L176 Q179 I181 R184 L196 R199
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0046872 metal ion binding

View graph for
Molecular Function
External links
PDB RCSB:6qdv, PDBe:6qdv, PDBj:6qdv
PDBsum6qdv
PubMed30705154
UniProtQ9NW64|RBM22_HUMAN Pre-mRNA-splicing factor RBM22 (Gene Name=RBM22)

[Back to BioLiP]