Structure of PDB 6gbz Chain M Binding Site BS02

Receptor Information

>6gbz Chain M (length=124) Species: 83333 (Escherichia coli K-12)

MLQPKRTKFRKMHKGRNRGLAQGTDVSFGSFGLKAVGRGRLTARQIEAAR
RAMTRAVKRQGKIWIRVFPDKPITGNVEYWVALIQPGKVLYEMDGVPEEL
AREAFKLAAAKLPIKTTFVTKTVM

Ligand information

>6gbz Chain B (length=119)

ugccuggcggccguagcgcgguggucccaccugaccccaugccgaacuca
gaagugaaacgccguagcgccgaugguaguguggggucuccccaugcgag
aguagggaacugccaggca

<<<<<<<<<<.....<<<<<<<<....<<<<<<<.............>>>
>..>>>...>>>>>>.>>.<<.......<<<<<<<<...>>>>>>>>...
....>>...>>>>>>>>>>

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6gbz Structural Visualization of the Formation and Activation of the 50S Ribosomal Subunit during In Vitro Reconstitution.
• Resolution: 3.8 Å
• Binding residue (original residue number in PDB): R18 R38
• Binding residue (residue number reindexed from 1): R18 R38

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0000027 ribosomal large subunit assembly
• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6gbz, PDBe:6gbz, PDBj:6gbz
• PDBsum: 6gbz
• PubMed: 29883607
• UniProt: P0ADY7|RL16_ECOLI Large ribosomal subunit protein uL16 (Gene Name=rplP)