Structure of PDB 6exn Chain M Binding Site BS02

Receptor Information
>6exn Chain M (length=255) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SWRDKSAKVQVKESELPSSIPAQTGLTFNIWYNKWSQGFAGNTRFVSPFA
LQPQLHSGKTRGDNDGQLFFCLFFAKGMCCLGPKCEYLHHIPDEEDIGKL
ALRTEVLDCFGREKFADYREDMGGIGSFRKKNKTLYVGGIDGALNSKHLK
PAQIESRIRFVFSRLGDIDRIRYVESKNCGFVKFKYQANAEFAKEAMSNQ
TLLLPSDKEWDDRREGTGLLVKWANEDPDPAAQKRLQEELKLESLNMMVH
LINNN
Ligand information
>6exn Chain I (length=39) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
guaugucuaaaguuaugcucuuauuuacuaacaaacuag
.......................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6exn Postcatalytic spliceosome structure reveals mechanism of 3'-splice site selection.
Resolution3.7 Å
Binding residue
(original residue number in PDB)		F41 N44 R46 Y138 G141 R174 S178 K179 N180 F183 L222 N227 D229 P230
Binding residue
(residue number reindexed from 1)		F39 N42 R44 Y136 G139 R172 S176 K177 N178 F181 L220 N225 D227 P228
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0017070 U6 snRNA binding
GO:0036002 pre-mRNA binding
GO:0046872 metal ion binding
Biological Process
GO:0000387 spliceosomal snRNP assembly
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0033120 positive regulation of RNA splicing
GO:0045292 mRNA cis splicing, via spliceosome
GO:0045787 positive regulation of cell cycle
Cellular Component
GO:0000974 Prp19 complex
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0071006 U2-type catalytic step 1 spliceosome
GO:0071007 U2-type catalytic step 2 spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6exn, PDBe:6exn, PDBj:6exn
PDBsum6exn
PubMed29146871
UniProtQ12046|CWC2_YEAST Pre-mRNA-splicing factor CWC2 (Gene Name=CWC2)

[Back to BioLiP]