Structure of PDB 5yi2 Chain M Binding Site BS02

Receptor Information
>5yi2 Chain M (length=146) Species: 272623 (Lactococcus lactis subsp. lactis Il1403) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GMSLANQIDQFLGTIMQFAENKHEILLGKCESDVKLTSTQEHILMLLAEQ
ISTNAKIAEKLKISPAAVTKALKKLQEQELIKSSRATNDERVVLWSLTEK
AVPVAKEHATHHEKTLSTYQELGNKFTDEEQEVISKFLSALTEEFQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5yi2 Allosteric histidine switch for regulation of intracellular zinc(II) fluctuation.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		N54 A55 P65 A66 T69
Binding residue
(residue number reindexed from 1)		N54 A55 P65 A66 T69
Binding affinityPDBbind-CN: Kd=72nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5yi2, PDBe:5yi2, PDBj:5yi2
PDBsum5yi2
PubMed29229866
UniProtQ9CDU5

[Back to BioLiP]