Structure of PDB 5x6e Chain M Binding Site BS02

Receptor Information

>5x6e Chain M (length=236) Species: 1639 (Listeria monocytogenes) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

NAQAEEFKKYLETNGIKPKQFHKKELIFNQWDPQEYCIFLYDGITKLTSI
SENGTIMNLQYYKGAFVIMSGFIDTETSVGYYNLEVISEQATAYVIKINE
LKELLSKNLTHFFYVFQTLQKQVSYSLAKFNDFSINGKLGSICGQLLILT
YVYGKETPDGIKITLDNLTMQELGYSSGIAHSSAVSRIISKLKQEKVIVY
KNSCFYVQNLDYLKRYAPKLDEWFYLACPATWGKLN

Ligand information

>5x6e Chain P (length=28) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gtaggcattaacatttgttaacgacgat

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5x6e Structural insights into glutathione-mediated activation of the master regulator PrfA in Listeria monocytogenes
Resolution	2.99 Å
Binding residue (original residue number in PDB)	M171 S187
Binding residue (residue number reindexed from 1)	M170 S186

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

	Cellular Component
GO:0005829	cytosol

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5x6e, PDBe:5x6e, PDBj:5x6e
PDBsum	5x6e
PubMed	28271443
UniProt	P22262\|PRFA_LISMO Listeriolysin regulatory protein (Gene Name=prfA)

[Back to BioLiP]